This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.

What is IGF-1 DES?

IGF-1 DES is a truncated version of IGF-1 in which the tripeptide Gly-Pro-Glu is absent from the N-terminus end of the protein. It is actually a naturally occurring variant of IGF-1 and has been found in the human brain, cow colostrum, and pig uterine tissue. IGF-1 DES is 10 times more potent than IGF-1 in stimulating hypertrophy and proliferation of cells because it is not affected by IGF-1 binding proteins and therefore is more bioavailable. There is interest in using the peptide to induce anabolism in catabolic conditions (e.g. chronic illness) and in the treatment of inflammatory bowel disease[1, p. 1].

IGF-1 DES has also been of keen interest in the treatment of a number of neurological and neurodevelopmental conditions. Researchers investigating autism and autism spectrum disorders have found that IGF-1 and its analogues have potent effects on the synaptic health neurons. In animal models of autism, IGF-1 DES and IGF-1 have relieved symptoms and improved a number of the behavioral aspects of the condition.

IGF-1 DES Structure

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA Molecular Formula: C319H495N91O96S7 Molecular Weight: 7365.4225 g/mol PubChem CID: 135331146 CAS Number: 112603-35-7 Synonyms: Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1

IGF-1 DES Research

IGF-1 DES Is More Potent Than IGF-1

IGF-1 DES is lacking just three amino acids from its N-terminal end, but that subtle change makes a big difference. Research shows that IGF-1 DES does not bind very well to IGF-1 binding proteins (IGFBPs) found in the blood and in various tissues throughout the body. The result is that more of the peptide is available for binding to important receptors and thus IGF-1 DES is more potent (same effects at lower doses) than IGF-1 itself. Research in pigs and marmoset’s indicates that IGF-1 DES is 2-3 times more potent than IGF-1 in lowering blood sugar. Further, these same potency effects extend to other properties of IGF-1 as well, including its anabolic effects on skeletal muscle and its neuroprotective effects[2].

One of the benefits of binding to IGFBPs is prolonged activity as a result of decreased clearance from the circulation. Thus, IGF-1 DES has a much faster onset of action, higher peak activity, and faster withdrawal than IGF-1 itself. There are a number of settings in which this type of efficacy profile could be useful, including the treatment of hyperglycemic conditions.

Research in pigs indicates that IGF-1 variants with low affinities for IGFBPs have a more dramatic effect on growth. In fact, the anabolic effects of IGF-1 DES occur even in the setting of limited calorie intake[3]. Research in rats shows that just 14 days of IGF-1 DES is enough to produce significant increases in body weight, nitrogen retention, and food conversion efficiency[4]. The latter fact is important as it confirms the potential of IGF-1 DES to improve anabolism even in the setting of poor calorie intake, a function that would make the peptide useful in chronic disease and in individuals who are unable to consume a great deal of calories for a variety of reasons. IGF-1 has also been shown to be a more effective anti-hyperglycemic agent, lower blood sugar rapid after administration. This is part of the reason the peptide is so efficient in boosting growth with lower calorie consumption. There is interest among researchers in using IGF-1 DES as a potential treatment in hyperglycemia were it would have similar effects to insulin administration without the long-term side effects that can occur if too much insulin is used.

IGF-1 DES Research and Neurological Disease

It has been long established that IGF-1 has important effects on neuron growth, differentiation, and survival. The protein is a major factor in synaptic formation and thus plays a critical role in learning, memory, and more. IGF-1 is particularly important for the development and maintenance of mature synapses. Research shows that IGF-1 is absolutely necessary for achieving proper levels of pres-synaptic synapsin-1, a protein that regulates the release of neurotransmitters. The peptide is also important for the post-synaptic PSD-95 protein, which maintains synaptic structure. Without IGF-1, synaptic development is disrupted and deficits in motor skills, behavior, cognitive functioning, and language all develop.

Important synaptic proteins affected by IGF-1 include synapsin-1, PSD-95, AMPA receptor, and NMDA receptor.

IGF-1 and its analogues have been tested in Rett syndrome and in chromosome 22 deletion syndrome. In both cases, the peptides yield positive benefits. By protecting the number of excitatory synapses in the brain and by preserving neuron density. IGF-1 has also been shown to reduce the toxic effects of NDMA over-stimulation, thereby protecting neurons from excitotoxity, which can lead to neuron death. The benefits were so great in animal studies that IGF-1 and its analogues are being introduced as experimental treatments in humans suffering from these devastating conditions[5].

Clinical trials of IGF-1 in multiple sclerosis (MS), ALS, Parkinson’s disease (PD), and Alzheimer’s disease (AD) have yielded mixed results. In ALS, for instance, IGF-1 treatment lead to significant reductions in disease progression, increased muscle strength, improved respiratory functioning, and increased quality of life. In MS, the peptide had almost no effect. Human trials of IGF-1 in PD have not yet been performed, but studies in rat models of PD indicate that it protects dopaminergic neurons and improves behavior[6]. Further study is required to understand the causes of these conditions and how IGF-1 DES plays a role in their treatment. The fact that the peptide has no impact on MS is not surprising as the condition is less caused by neuron death than by damage to the cells around neurons. IGF-1 DES and other IGF-1 analogues can help scientists to explore the basic pathophysiology of these conditions in order to better under their causes and thus develop potential treatments.

IGF-1 DES and Autism

Research shows that IGF-1 may be an important constituent in a number of neurological conditions, including autism. In fact, children with autism show lower brain levels of IGF-1 than age-matched controls, suggesting that low IGF-1 concentrations in the brain, particularly at an early age, may disrupt normal development and be important in the pathogenesis of autism[7].

Research in mouse models of autism indicate that IGF-II and analogues like IGF-1 DES reverse all deficits associated with the conditions. Mice administered IGF-II for just five days showed improved social interaction, better novel-object recognition, enhanced contextual fear conditioning, reduced repetitive/compulsive behavior, better grooming, and more. The mice even showed improve memory[8].

These findings should not come as any surprise as research suggests that autism is likely caused by disruptions in synapse development and is similar pathologically, to other neurodevelopmental conditions like fragile X syndrome, tuberous sclerosis, and Angelman syndrome. IGF-1 and its analogues, which have potent effects on synapses, are therefore ideal candidates for exploring various treatment strategies in these disorders[9].

IGF-1 DES May Have Cognitive Benefits in Age

IGF-1 is important in adults as well as children. In adults, the peptide is actually heavily modified in the brain to make it shorter, indicating that analogues like IGF-1 DES may have better therapeutic potential than intact IGF-1. Molecules like IGF-1 DES also penetrate the blood-brain barrier more readily, making them more effective when administered exogenously. In adults, IGF-1 and its analogues have been shown to reduce neuronal death and protect neurons against insults like stroke, Alzheimer’s disease, Parkinson’s disease, and more[10].

From the above, it is clear that IGF-1 and its analogues are useful in the setting of neurological disease. Research in rats, however, suggests that IGF-1 DES may enhance synaptic transmission and impart cognitive benefits even in normal rats. This could be of benefit to learning and memory, particularly as organisms age and natural levels of IGF-1 in the brain begin to decline. According to research, IGF-1 DES causes a 40% increase in excitatory post-synaptic potential[11]. This suggests that the peptide could have profound effects on cognitive function, particularly in age-related synaptic dysfunction.

IGF-1 DES Research and Immune Function

Many cells in the immune system, such as mononuclear cells and neutrophils, have IGF-1 receptors on their surface. Research shows that IGF-1 DES can improve immune function by boosting release of hydrogen peroxide in mononuclear cells and by encouraging neutrophils to differentiate into pathogen-killing blastocytes[12]. In all cases, IGF-1 DES is more potent in stimulating these changes than IGF-1, indicating that the peptide might be an effective adjuvant to antibiotics and other treatments used in the setting of infectious disease. Research into the role of IGF-1 DES in stimulating immune function is very preliminary, but still very promising.

IGF-1 DES May Improve Wound Healing

Dermal (skin) fibroblasts are the cell primarily responsible for tissue repair following injury. These cells turn out to produce a number of IGFBPs under certain circumstances and it is known that this protein drastically lowers the impact of IGF-1 at its other receptors. Research suggests that inflammatory cytokines can alter IGFBP levels, which may impact healing. By administering peptides that are unaffected by IGFBP, it is possible to circumvent the effects of inflammatory cytokines and improve fibroblast growth and differentiation[13]. This, in turn, can accelerate wound healing.

IGF-1 DES Research and Cancer

One of the problems that cancer cells present is the fact that they are undifferentiated or exist at very earlier stages of differentiation. This makes the cells difficult to treat and also makes them dysfunctional. Most importantly, cells in later stages of differentiation grow more slowly. Forcing cancer cells to differentiate could slower tumor growth. Research in cell culture indicates that IGF-1 DES can force certain types of cancer cell to differentiate, which slows tumor growth by inhibiting differentiation[14, p. 1].

IGF-1 DES Is a New Contender

IGF-1 DES preserves many of the functions of IGF-1, such as enhanced skeletal muscle growth and protection of neurons. It is different, however, in that it does not bind to IGFBPs. This fact alone makes IGF-1 DES more useful in a number of ways, such as allowing the peptide to more easily pass into the brain when administered exogenously. IGF-1 DES hold a great deal of promise, which is why it is the subject of intense research in fields that touch on neurodevelopment, stroke, cancer, wound healing, autism, and more.

IGF-1 DES exhibits moderate side effects, low oral and excellent subcutaneous bioavailability in mice. Per kg dosage in mice does not scale to humans. IGF-1 DES for sale at  peptide Review Hub is limited to educational and scientific research only, not for human consumption. Only buy IGF-1 DES if you are a licensed researcher.

IGF-1 DES (Des(1-3) IGF-1) is a naturally occurring truncated variant of Insulin-Like Growth Factor-1 (IGF-1) that has gained significant interest in research involving cellular growth, tissue repair, neurodevelopment, muscle biology, synaptic function, wound healing, and regenerative medicine. Researchers investigate IGF-1 DES because it demonstrates reduced interaction with IGF-binding proteins (IGFBPs), resulting in greater biological availability and distinct signaling characteristics compared to native IGF-1.

As interest in anabolic, neurological, and regenerative peptide research continues to expand, researchers frequently compare IGF-1 DES suppliers based on purity, analytical testing, manufacturing quality, pricing, and supplier transparency.

This IGF-1 DES Vendor Price Comparison Guide helps researchers evaluate suppliers using objective criteria including:

• Product Pricing

• Cost Per Milligram

• Product Purity

• Third-Party Testing

• Certificate of Analysis (COA)

• Vendor Reputation

• Customer Reviews

• Shipping Performance

• Product Availability

• Overall Value

Whether you're searching for the lowest-priced IGF-1 DES supplier, the highest-purity research-grade product, or vendors offering extensive laboratory verification, this guide provides a framework for comparing research peptide suppliers.

Explore IGF-1 DES Vendors by Criteria

Most Popular IGF-1 DES Vendors

Compare suppliers frequently selected by regenerative and growth-factor researchers.

Highest Reviewed IGF-1 DES Vendors

Discover peptide suppliers with strong customer satisfaction and positive marketplace reputations.

Lowest Price IGF-1 DES Vendors

Identify vendors offering competitive pricing and favorable cost-per-milligram value.

Highest Purity IGF-1 DES Vendors

Review suppliers providing transparent purity verification and analytical testing.

Best Value IGF-1 DES Vendors

Compare pricing, testing standards, product quality, and customer support.

Fastest Shipping IGF-1 DES Vendors

Evaluate shipping reliability, fulfillment performance, and packaging quality.

Newly Listed IGF-1 DES Vendors

Explore recently added suppliers offering IGF-1 DES research peptides.

What Is IGF-1 DES?

Overview

IGF-1 DES is a naturally occurring truncated form of IGF-1 in which the N-terminal tripeptide sequence Gly-Pro-Glu is absent.

Researchers investigate IGF-1 DES because of its relationship with:

• Cellular proliferation

• Tissue growth

• Skeletal-muscle biology

• Neurodevelopment

• Synaptic maintenance

• Wound healing

• Immune-system signaling

• Growth-factor communication

IGF-1 DES has become an important compound in growth-factor and regenerative biology research.

Molecular Characteristics

Peptide Information

Researchers evaluating IGF-1 DES products should carefully review analytical documentation and molecular specifications.

Peptide Name

IGF-1 DES

Alternative Names

• Des(1-3) IGF-1

• 4-70 Insulin-Like Growth Factor-1

• Insulin-Like Growth Factor-1 DES

Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA

Molecular Formula

C319H495N91O96S7

Molecular Weight

7365.4225 g/mol

PubChem CID

135331146

CAS Number

112603-35-7

Classification

Insulin-Like Growth Factor Analogue

Research Category

Growth Factor & Regenerative Research

Why Researchers Study IGF-1 DES

IGF-1 DES differs from native IGF-1 because it displays reduced binding to IGF-binding proteins (IGFBPs).

Researchers investigate this characteristic because it may influence:

• Biological availability

• Cellular receptor interaction

• Growth-factor signaling

• Tissue-specific activity

• Cellular adaptation

• Growth-related pathways

This distinction remains one of the most important reasons for continued research interest.

Why Researchers Compare IGF-1 DES Vendors

Research reproducibility depends heavily on peptide quality and manufacturing consistency.

Differences among suppliers may include:

• Purity levels

• Batch consistency

• Stability testing

• Manufacturing standards

• Storage conditions

• Product documentation

• Analytical verification

• Quality-control procedures

Careful supplier evaluation can improve consistency and reliability across research studies.

How We Compare IGF-1 DES Vendors

Third-Party Laboratory Testing

Independent testing remains one of the strongest indicators of peptide quality.

Researchers should prioritize suppliers offering:

• Third-party analytical testing

• Identity verification

• Purity confirmation

• Batch-specific testing reports

Certificate of Analysis (COA)

A quality COA should include:

• Batch number

• Analytical test date

• Purity percentage

• Identity verification

• Testing methodology

Product Purity

Purity remains one of the most important variables when evaluating research peptides.

Higher-purity materials generally contribute to improved experimental consistency and reproducibility.

Cost Per Milligram

Comparing vial prices alone may not accurately reflect overall value.

Cost Per Milligram Formula

Product Price ÷ Total Milligrams = Cost Per Milligram

This metric allows researchers to compare suppliers more effectively.

Customer Reviews

Customer experiences often provide insight regarding:

• Product consistency

• Packaging quality

• Shipping reliability

• Customer support

• Purchasing experience

Vendor Reputation

Established suppliers often demonstrate:

• Transparent quality-control procedures

• Reliable testing standards

• Consistent inventory availability

• Positive customer satisfaction

Current Research & Evidence

Growth-Factor Research

One of the primary focuses of IGF-1 DES research involves growth-factor signaling.

Researchers continue investigating:

• Cellular growth pathways

• Receptor communication

• Growth-factor biology

• Cellular adaptation

• Metabolic regulation

This remains a foundational area of investigation.

Cellular Proliferation Research

Experimental studies examine pathways involving:

• Cell proliferation

• Cellular differentiation

• Growth-factor communication

• Tissue development

• Regenerative biology

Researchers continue studying these mechanisms.

Key Areas of IGF-1 DES Research

Skeletal Muscle Research

Researchers investigate IGF-1 DES because of its relationship with:

• Muscle-cell signaling

• Cellular growth pathways

• Tissue adaptation

• Nitrogen retention

• Skeletal-muscle biology

This remains one of the most frequently discussed areas of research.

Neurodevelopment Research

Scientists continue examining pathways involving:

• Synapse formation

• Neuronal development

• Neural communication

• Synaptic maintenance

• Brain maturation

IGF-1 signaling remains critical to neurodevelopmental research.

Neurological Research

Researchers investigate IGF-1 DES in studies involving:

• Neuron survival

• Synaptic health

• Neuroprotection

• Neural adaptation

• Central nervous system signaling

Additional investigations continue in this area.

Autism-Spectrum Research

Experimental models continue exploring pathways involving:

• Synaptic function

• Neurodevelopment

• Neural communication

• Behavioral biology

• Brain signaling pathways

Research remains ongoing.

Cognitive Function Research

Researchers investigate pathways associated with:

• Learning mechanisms

• Memory processes

• Synaptic transmission

• Cognitive adaptation

• Age-related neural changes

This remains a growing area of interest.

Healthy Aging Research

Scientists continue exploring relationships involving:

• Brain aging

• Synaptic maintenance

• Cellular resilience

• Neuroprotective signaling

• Cognitive preservation

Further research remains necessary.

Immune-System Research

IGF-1 DES has generated interest in studies involving:

• Immune-cell signaling

• Neutrophil biology

• Cellular communication

• Immune adaptation

• Host-defense pathways

This remains an emerging research field.

Wound-Healing Research

Researchers continue examining:

• Fibroblast activity

• Tissue repair mechanisms

• Cellular migration

• Regenerative signaling

• Structural remodeling

Additional studies remain ongoing.

Cancer Biology Research

Experimental studies investigate pathways involving:

• Cellular differentiation

• Growth regulation

• Tumor-cell biology

• Cell-cycle signaling

• Growth-factor communication

Research in this area remains preliminary and exploratory.

Potential Areas of Future Research

Researchers continue exploring IGF-1 DES in studies involving:

• Neurodevelopment

• Healthy cognitive aging

• Tissue regeneration

• Growth-factor signaling

• Neurological disorders

• Immune-system biology

• Wound healing

• Regenerative medicine

Scientific interest in these research areas continues to expand.

Research Limitations

Most findings involving IGF-1 DES originate from:

• Cell-culture studies

• Animal models

• Laboratory investigations

• Preclinical research

Additional studies are necessary to fully characterize biological mechanisms and long-term effects.

Research findings should not be interpreted as evidence of approved therapeutic applications.

Product Quality & Analytical Testing

Why Testing Matters

Research-grade IGF-1 DES products should undergo testing to verify:

• Identity

• Purity

• Stability

• Potency

• Batch consistency

Common Testing Methods

High-Performance Liquid Chromatography (HPLC)

Used to assess peptide purity and identify impurities.

Mass Spectrometry (MS)

Used to verify molecular identity and composition.

Identity Verification Testing

Confirms peptide authenticity.

Stability Testing

Evaluates peptide integrity under storage conditions.

Batch Consistency Testing

Measures reproducibility across manufacturing lots.

Understanding IGF-1 DES Pricing

Several variables influence pricing among peptide suppliers.

Product Purity

Higher-purity products often command premium pricing.

Complex Manufacturing

Large growth-factor peptides typically require specialized synthesis and quality-control procedures.

Analytical Verification

Comprehensive testing programs improve transparency while increasing manufacturing costs.

Research Demand

Growing interest in regenerative and neurological research contributes to increased demand.

Vendor Reputation

Trusted suppliers often charge more due to established quality-assurance standards.

IGF-1 DES Vendor Evaluation Checklist

Quality Verification

✅ Third-party testing available

✅ Certificate of Analysis provided

✅ Identity verification documented

✅ Purity information disclosed

✅ Batch-specific testing available

✅ Stability information available

Vendor Reliability

✅ Positive customer reviews

✅ Transparent company information

✅ Responsive customer support

✅ Reliable inventory availability

Purchasing Experience

✅ Secure checkout process

✅ Shipment tracking available

✅ Clear refund policies

✅ Reliable order fulfillment

Red Flags When Comparing Vendors

Testing Concerns

❌ No third-party testing

❌ Missing COAs

❌ Unverified purity claims

❌ Missing identity verification

❌ Outdated laboratory reports

Transparency Issues

❌ Hidden specifications

❌ Missing batch information

❌ Limited documentation

❌ No supplier contact information

Service Problems

❌ Frequent inventory shortages

❌ Poor communication

❌ Negative customer reviews

❌ Unclear shipping policies

Frequently Asked Questions

What is IGF-1 DES?

IGF-1 DES is a naturally occurring truncated variant of Insulin-Like Growth Factor-1 that exhibits reduced interaction with IGF-binding proteins and is widely investigated in growth-factor research.

What is IGF-1 DES used for in research?

Researchers investigate IGF-1 DES in studies involving cellular growth, skeletal-muscle biology, neurodevelopment, synaptic function, wound healing, immune signaling, tissue regeneration, and growth-factor communication.

Why compare IGF-1 DES vendors?

Purity, analytical testing, documentation quality, pricing, and supplier reliability can vary substantially among peptide vendors.

What should researchers review before purchasing?

Researchers should evaluate:

• Certificate of Analysis (COA)

• Third-party testing

• Purity verification

• Identity confirmation

• Vendor reputation

• Customer reviews

Why is third-party testing important?

Independent testing helps verify peptide identity, purity, and batch consistency while improving transparency and reproducibility.

Is the lowest-priced supplier always the best choice?

No. Product quality, analytical verification, supplier reliability, and documentation are often more important than price alone.

How often should vendor comparisons be updated?

Pricing, supplier policies, inventory levels, and laboratory reports can change frequently and should be reviewed regularly.

Final Thoughts

IGF-1 DES remains one of the most extensively researched growth-factor peptides because of its unique relationship with cellular proliferation, neurodevelopment, synaptic biology, tissue regeneration, wound healing, immune signaling, and growth-factor communication. Its reduced interaction with IGF-binding proteins distinguishes it from native IGF-1 and continues to drive scientific interest across multiple research disciplines.

When comparing IGF-1 DES vendors, researchers should prioritize purity verification, third-party analytical testing, Certificate of Analysis availability, supplier reputation, and overall value rather than focusing exclusively on cost. A structured vendor-comparison process can help identify suppliers capable of meeting rigorous research-quality standards.