This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.

What is IGF1-LR3?

IGF1-LR3 is a modified version of insulin-like growth factor-1. The full name of the peptide is insulin-like growth factor-1 long arginine 3. All IGF-1 derivatives play prominent roles in cell division, cell proliferation, and cell-to-cell communication. Though it has similar effects, IGF-1 LR3 does not adhere to IGF binding proteins as strongly as IGF-1. This results in IGF1-LR3 remaining in the bloodstream 120 times longer than IGF-1. IGF1-LR3 gains its prolonged half-life as a result of its structural changes. The peptide is created by adding 13 amino acids to the N-terminal end of IGF-1 and by converting the glutamic acid at position 3 of IGF-1 to an arginine residue.

IGF1-LR3 Structure

Sequence: MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIVDEC CFRSCDLRRL EMYCAPLKPA KSA Molecular Formula: C400H625N111O115S9 Molecular Weight: 9117.5 g/mol CAS Number: 946870-92-4

IGF1-LR3 Research

Cell Division

Like IGF-1, IGF1-LR3 is a potent stimulus for cell division and proliferation. Its primary effects are on connective tissues like muscle and bone, but it also promotes cell division in liver, kidney, nerve, skin, lung, and blood tissues. IGF-1 is best thought of as a maturation hormone because it not only promotes cell proliferation, but differentiation as well. IGF-1 causes cells to mature, in other words, so that they can carry out their specialized functions.

Unlike IGF-1, IGF1-LR3 remains in the bloodstream for long periods of time. This property makes IGF1-LR3 a much more potent molecule. A dose of IGF1-LR3 provides approximately three times as much cell activation as a similar dose of IGF-1. Note that IGF1-LR3 and all IGF-1 derivatives do not promote cell enlargement (hypertrophy), but rather promote cell division and proliferation (hyperplasia). In the case of muscle, for instance, IGF1-LR3 does not cause muscle cells to get larger, but it does increase total numbers of muscle cells.

Fat Metabolism and Diabetes

IGF1-LR3 boosts fat metabolism in an indirect manner by binding to both the IGF-1R receptor and the insulin receptor. These actions increase glucose uptake from the blood by muscle, nerve, and liver cells. This results in an overall decrease in blood sugar levels, which then triggers adipose tissue as well as the liver to begin breaking down glycogen and triglycerides. Overall, this produces a net decrease in adipose tissue and a net energy consumption (i.e. net catabolism).

Given its role in reducing blood sugar levels, it should come as no surprise that IGF1-LR3 reduces insulin levels as well as the need for exogenous insulin in diabetes. In most cases, this translates into a 10% decrease in insulin requirements to maintain the same blood sugar levels. This fact may help scientists understand how to decrease insulin doses in individuals who have decreased insulin sensitivity and may even offer insight into preventing type 2 diabetes in the first place.

Impairs Myostatin

Myostatin (a.k.a. growth differentiation factor 8) is a muscle protein that primarily inhibits the growth and differentiation of muscle cells. While this function is important to prevent unregulated hypertrophy and ensure proper healing following injury, there are times when inhibiting myostatin could be of benefit. The ability to stop myostatin from functioning could be useful in conditions like Duchenne muscle dystrophy (DMD) or in people who suffer muscle loss during prolonged immobility. In these cases, inhibiting this natural enzyme could help to slow muscle breakdown, maintain strength, and stave off morbidity.

​In mouse models of DMD, it has been found that IGF1-LR3 and other IGF-1 derivatives are capable of counteracting the negative effects of myostatin to protect muscle cells and prevent apoptosis. IGF1-LR3, thanks to its long half-life, is highly effective in counteracting myostatin and appears to work by activating a muscle protein called MyoD[1], [2]. MyoD is the protein normally activated by exercise (e.g. weight lifting) or tissue damage and is responsible for muscle hypertrophy.

IGF1-LR3 Longevity Research

IGF1-LR3 promotes tissue repair and maintenance throughout the body, making it a protective molecule against cell damage and the effects of aging. Research in cows and pigs indicates that IGF1-LR3 administration may be an effective solution for offsetting the effects of cellular aging. Ongoing research in mice seeks to determine if IGF1-LR3 might be useful in preventing progression of a wide range of conditions such as dementia, muscle atrophy, and kidney disease. This research reveals that IGF-1 administration can prolong life and reduce disability[3], [4], [5, p. 1].

Lifespan of male and female mice is correlated with IGF-1 levels. Source: ResearchGate

Glucocorticoid Signaling

Glucocorticoids, secreted primarily by the adrenal glands, are important clinical drugs used to control pain and reduce inflammation in autoimmune diseases, neurological injury, cancer, and more. Unfortunately, glucocorticoids have a number of undesirable side effects such as muscle wasting, fat gain, and deterioration of bone density. There is some interest in using IGF1-LR3 to reduce the side effects of glucocorticoids and thus allow for more effective therapy[6].

IGF1-LR3 exhibits minimal to moderate side effects, low oral and excellent subcutaneous bioavailability in mice. Per kg dosage in mice does not scale to humans. IGF1-LR3 for sale at  peptide Review Hub is limited to educational and scientific research only, not for human consumption. Only buy IGF1-LR3 if you are a licensed researcher.​

Scientific Journal Author

Dr. Anastasios Philippou, Ph.D. focused on Experimental Physiology at the National & Kapodistrian University of Athens Medical School. He is now a National Center Manager and Assistant Professor, however his extensive studying and documented research pertaining to the effects of muscle regeneration, the role of IGF-1 in skeletal muscle physiology, the expression of IGF-1 isoforms after exercise induced muscle damage in humans, characterization of the MGF E peptide actions in vitro, and epigenetic regulation on gene expression induced by physical exercise are most impressive.

Dr. Anastasios Philippou, Ph.D. is being referenced as one of the leading scientists involved in the research and development of IGF1-LR3. In no way is this doctor/scientist endorsing or advocating the purchase, sale, or use of this product for any reason. There is no affiliation or relationship, implied or otherwise, between  peptide Review Hub and this doctor. The purpose of citing the doctor is to acknowledge, recognize, and credit the exhaustive research and development efforts conducted by the scientists studying this peptide. Dr. Anastasios Philippou, Ph.D. is listed in [7] and [8] under the referenced citations.

IGF-1 LR3 (Insulin-Like Growth Factor-1 Long Arginine 3) is a modified IGF-1 analogue widely investigated in growth-factor signaling, cellular proliferation, skeletal muscle biology, metabolic regulation, tissue repair, longevity research, and regenerative medicine. Researchers study IGF-1 LR3 because its structural modifications result in significantly prolonged biological activity and reduced binding to IGF-binding proteins (IGFBPs) compared to native IGF-1.

As interest in growth-factor and regenerative research continues to expand, researchers frequently compare IGF-1 LR3 suppliers based on purity, analytical testing, manufacturing quality, pricing, and supplier transparency.

This IGF-1 LR3 Vendor Price Comparison Guide helps researchers evaluate suppliers using objective criteria including:

• Product Pricing

• Cost Per Milligram

• Product Purity

• Third-Party Testing

• Certificate of Analysis (COA)

• Vendor Reputation

• Customer Reviews

• Shipping Performance

• Product Availability

• Overall Value

Whether you're searching for the lowest-priced IGF-1 LR3 supplier, the highest-purity research-grade material, or vendors offering comprehensive laboratory verification, this guide provides a framework for comparing research peptide suppliers.

Explore IGF-1 LR3 Vendors by Criteria

Most Popular IGF-1 LR3 Vendors

Compare suppliers frequently selected by growth-factor and regenerative researchers.

Highest Reviewed IGF-1 LR3 Vendors

Discover peptide suppliers with strong customer satisfaction and positive marketplace reputations.

Lowest Price IGF-1 LR3 Vendors

Identify vendors offering competitive pricing and favorable cost-per-milligram value.

Highest Purity IGF-1 LR3 Vendors

Review suppliers providing transparent purity verification and analytical testing.

Best Value IGF-1 LR3 Vendors

Compare pricing, laboratory standards, documentation quality, and customer support.

Fastest Shipping IGF-1 LR3 Vendors

Evaluate shipping reliability, packaging quality, and order-fulfillment performance.

Newly Listed IGF-1 LR3 Vendors

Explore recently added suppliers offering IGF-1 LR3 research peptides.

What Is IGF-1 LR3?

Overview

IGF-1 LR3 is a modified version of Insulin-Like Growth Factor-1 (IGF-1) engineered to exhibit prolonged activity and altered interactions with IGF-binding proteins.

Researchers investigate IGF-1 LR3 because of its relationship with:

• Cellular proliferation

• Cellular differentiation

• Growth-factor signaling

• Skeletal-muscle biology

• Bone biology

• Metabolic regulation

• Tissue maintenance

• Regenerative physiology

IGF-1 LR3 remains one of the most widely studied growth-factor analogues in modern peptide research.

Molecular Characteristics

Peptide Information

Researchers evaluating IGF-1 LR3 products should carefully review analytical documentation and molecular specifications.

Peptide Name

IGF-1 LR3

Full Name

Insulin-Like Growth Factor-1 Long Arginine 3

Classification

IGF-1 Analogue

Research Category

Growth Factor & Regenerative Research

Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

C400H625N111O115S9

Molecular Weight

9117.5 g/mol

CAS Number

946870-92-4

Product Format

Lyophilized Peptide Preparation

How IGF-1 LR3 Differs from IGF-1

IGF-1 LR3 was developed through structural modifications to native IGF-1.

Key differences include:

• Addition of 13 amino acids at the N-terminal region

• Arginine substitution at position 3

• Reduced binding to IGF-binding proteins (IGFBPs)

• Increased biological availability

• Extended duration of activity

These characteristics make IGF-1 LR3 a distinct compound from native IGF-1 and a valuable tool for growth-factor research.

Why Researchers Compare IGF-1 LR3 Vendors

Research reproducibility depends heavily on peptide quality and manufacturing consistency.

Differences among suppliers may include:

• Product purity

• Batch consistency

• Stability testing

• Manufacturing standards

• Analytical verification

• Product documentation

• Storage protocols

• Quality-control systems

Careful supplier evaluation may improve consistency and reliability across research studies.

How We Compare IGF-1 LR3 Vendors

Third-Party Laboratory Testing

Independent testing remains one of the strongest indicators of peptide quality.

Researchers should prioritize suppliers offering:

• Third-party laboratory testing

• Identity verification

• Purity confirmation

• Batch-specific laboratory reports

Certificate of Analysis (COA)

A quality COA should contain:

• Batch number

• Testing date

• Purity percentage

• Identity confirmation

• Analytical methodology

Product Purity

Purity remains one of the most important variables when evaluating research peptides.

Higher-purity products generally contribute to improved experimental consistency and reproducibility.

Cost Per Milligram

Comparing vial prices alone may not accurately represent overall value.

Cost Per Milligram Formula

Product Price ÷ Total Milligrams = Cost Per Milligram

This metric allows researchers to compare suppliers more effectively.

Customer Reviews

Customer experiences often provide insight regarding:

• Product consistency

• Packaging quality

• Shipping reliability

• Customer support

• Purchasing experience

Vendor Reputation

Established suppliers often demonstrate:

• Transparent quality standards

• Reliable testing procedures

• Strong customer satisfaction

• Consistent inventory availability

Current Research & Evidence

Growth Factor Research

The primary focus of IGF-1 LR3 research involves growth-factor signaling.

Researchers continue investigating:

• Cell signaling pathways

• Cellular growth

• Cellular differentiation

• Tissue adaptation

• Growth-factor communication

This remains the central area of scientific interest.

Cellular Proliferation Research

Researchers investigate pathways involving:

• Cell division

• Cellular replication

• Growth regulation

• Tissue maintenance

• Organ-system development

IGF-1 LR3 remains extensively studied in these areas.

Cellular Differentiation Research

Research continues examining pathways associated with:

• Cellular maturation

• Tissue specialization

• Growth-factor regulation

• Cellular development

• Regenerative biology

These pathways remain fundamental to growth-factor science.

Key Areas of IGF-1 LR3 Research

Skeletal Muscle Research

Researchers investigate IGF-1 LR3 because of its relationship with:

• Muscle-cell signaling

• Cellular proliferation

• Skeletal-muscle physiology

• Growth-factor pathways

• Tissue maintenance

This remains one of the most active areas of investigation.

Bone Biology Research

Researchers continue studying:

• Bone-cell communication

• Skeletal development

• Structural adaptation

• Growth-factor signaling

• Bone metabolism

Additional studies remain ongoing.

Fat Metabolism Research

Experimental investigations continue examining pathways involving:

• Glucose utilization

• Energy balance

• Adipose-tissue biology

• Metabolic communication

• Nutrient utilization

This remains an important area of metabolic research.

Diabetes & Glucose Research

Researchers investigate pathways involving:

• Glucose regulation

• Insulin signaling

• Metabolic physiology

• Endocrine communication

• Cellular energy utilization

Further investigation remains ongoing.

Myostatin Research

Scientists continue studying relationships involving:

• Myostatin signaling

• Muscle-cell regulation

• Growth-factor communication

• Tissue maintenance

• Cellular adaptation

Research in this area remains active.

Longevity Research

Researchers investigate IGF-1 LR3 because of its relationship with:

• Healthy aging biology

• Tissue maintenance

• Cellular resilience

• Regenerative signaling

• Growth-factor pathways

Interest in longevity-related growth-factor research continues to expand.

Tissue Repair Research

Experimental studies continue examining:

• Tissue maintenance

• Cellular regeneration

• Repair-associated signaling

• Growth-factor communication

• Structural adaptation

This remains a major area of research interest.

Glucocorticoid Research

Researchers continue exploring pathways involving:

• Endocrine signaling

• Growth-factor interactions

• Tissue maintenance

• Cellular adaptation

• Metabolic regulation

Further studies remain necessary.

Potential Areas of Future Research

Researchers continue exploring IGF-1 LR3 in studies involving:

• Healthy aging

• Growth-factor biology

• Skeletal-muscle physiology

• Bone biology

• Tissue regeneration

• Metabolic regulation

• Cellular communication

• Neurobiological signaling

Interest in these fields continues to increase.

Research Limitations

Most findings involving IGF-1 LR3 originate from:

• Cell-culture studies

• Animal models

• Laboratory investigations

• Preclinical growth-factor research

Additional studies remain necessary to fully characterize biological mechanisms and long-term outcomes.

Research findings should not be interpreted as evidence of approved therapeutic applications.

Product Quality & Analytical Testing

Why Testing Matters

Research-grade IGF-1 LR3 products should undergo testing to verify:

• Identity

• Purity

• Stability

• Potency

• Batch consistency

Common Testing Methods

High-Performance Liquid Chromatography (HPLC)

Used to evaluate purity and identify impurities.

Mass Spectrometry (MS)

Used to verify molecular identity and composition.

Identity Verification Testing

Confirms peptide authenticity.

Stability Testing

Evaluates peptide integrity during storage.

Batch Consistency Testing

Measures reproducibility across manufacturing lots.

Understanding IGF-1 LR3 Pricing

Several factors influence pricing among suppliers.

Product Purity

Higher-purity products often command premium pricing.

Complex Manufacturing

Large growth-factor peptides require sophisticated synthesis and quality-control procedures.

Analytical Verification

Comprehensive testing improves transparency while increasing manufacturing costs.

Research Demand

Growing interest in regenerative and growth-factor research contributes to market demand.

Vendor Reputation

Established suppliers often command higher prices due to stronger quality-assurance standards.

IGF-1 LR3 Vendor Evaluation Checklist

Quality Verification

✅ Third-party testing available

✅ Certificate of Analysis provided

✅ Identity verification documented

✅ Purity information disclosed

✅ Batch-specific testing available

✅ Stability information available

Vendor Reliability

✅ Positive customer reviews

✅ Transparent company information

✅ Responsive customer support

✅ Reliable inventory availability

Purchasing Experience

✅ Secure checkout process

✅ Shipment tracking available

✅ Clear refund policies

✅ Reliable order fulfillment

Red Flags When Comparing Vendors

Testing Concerns

❌ No third-party testing

❌ Missing COAs

❌ Unverified purity claims

❌ Missing identity verification

❌ Outdated laboratory reports

Transparency Issues

❌ Hidden specifications

❌ Missing batch information

❌ Limited documentation

❌ No supplier contact information

Service Problems

❌ Frequent inventory shortages

❌ Poor communication

❌ Negative customer reviews

❌ Unclear shipping policies

Frequently Asked Questions

What is IGF-1 LR3?

IGF-1 LR3 is a modified analogue of Insulin-Like Growth Factor-1 engineered for prolonged activity and reduced binding to IGF-binding proteins.

What is IGF-1 LR3 used for in research?

Researchers investigate IGF-1 LR3 in studies involving cellular proliferation, growth-factor signaling, skeletal-muscle biology, bone physiology, metabolic regulation, tissue repair, and healthy-aging research.

Why compare IGF-1 LR3 vendors?

Purity, analytical testing, pricing, documentation quality, and supplier reliability can vary significantly among peptide suppliers.

What should researchers review before purchasing?

Researchers should evaluate:

• Certificate of Analysis (COA)

• Third-party testing

• Purity verification

• Identity confirmation

• Vendor reputation

• Customer reviews

Why is third-party testing important?

Independent testing helps verify product identity, purity, and batch consistency while improving transparency and reproducibility.

Is the cheapest supplier always the best option?

No. Product quality, analytical verification, supplier reliability, and documentation quality are often more important than price alone.

How often should vendor comparisons be updated?

Pricing, inventory availability, laboratory reports, and supplier policies can change frequently and should be reviewed regularly.

Final Thoughts

IGF-1 LR3 remains one of the most extensively researched growth-factor peptides because of its prolonged activity, reduced interaction with IGF-binding proteins, and broad relevance to cellular proliferation, tissue maintenance, skeletal-muscle biology, metabolic regulation, and regenerative science. Ongoing investigations continue expanding scientific understanding of growth-factor signaling, cellular adaptation, and healthy aging biology.

When comparing IGF-1 LR3 vendors, researchers should prioritize purity verification, third-party analytical testing, Certificate of Analysis availability, supplier reputation, and overall value rather than focusing exclusively on price. A structured vendor-comparison approach can help identify suppliers capable of meeting rigorous research-quality standards.